Tunturiibacter gelidiferens: RBB81_05070 Help Entry RBB81_05070       CDS       T10211                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism tgi  Tunturiibacter gelidiferens Brite KEGG Orthology (KO) [BR:tgi00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:tgi03032]     RBB81_05070    03036 Chromosome and associated proteins [BR:tgi03036]     RBB81_05070    03400 DNA repair and recombination proteins [BR:tgi03400]     RBB81_05070 DNA replication proteins [BR:tgi03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     RBB81_05070 Chromosome and associated proteins [BR:tgi03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     RBB81_05070 DNA repair and recombination proteins [BR:tgi03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       RBB81_05070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  XCB23299 UniProt:  A0AAU7Z436 LinkDB All DBs Position complement(1086684..1086980) Genome browser AA seq 98 aa AA seqDB search MAKGMTKTALVRHLAEKLELTNKQTAGFLELLAETAVKETKKNGEFTIPGIGKLVKAERK ARLGRNPQTGETIKIKAKTVVKFRVAKVAKDTIAPVKK NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atggcaaagggaatgacaaagacagcgctggttcgccacctggcggaaaagctcgaactc accaacaagcagaccgctggtttcctggaactgctggcagagaccgcagtgaaagagacc aagaagaatggcgagttcaccattcctgggatcggcaagctggtaaaggcagagcgtaag gcgcgtcttggccgcaacccgcagacgggtgagaccatcaagatcaaggccaagaccgtg gtgaagttccgcgtggccaaggttgcaaaggacacaatcgcaccggtaaagaagtag

DBGET integrated database retrieval system