Tunturiibacter gelidiferens: RBB81_08975 Help Entry RBB81_08975       CDS       T10211                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tgi  Tunturiibacter gelidiferens Pathway tgi01100   Metabolic pathways tgi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tgi00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     RBB81_08975    00074 Mycolic acid biosynthesis     RBB81_08975   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     RBB81_08975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Skp1_POZ Motif Other DBs NCBI-ProteinID:  XCB24043 UniProt:  A0AAU7Z5A4 LinkDB All DBs Position complement(2032647..2032904) Genome browser AA seq 85 aa AA seqDB search MNDIATRCIDIIAKSKSIPADSISLANTFDELNIDSLDKINISFEVEEAFNIEIPDEALS TLRTVGDMVEGVAKLTTAPAHITTP NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaacgatatcgccacacgctgcattgacatcatcgctaaatctaaaagcatccccgcg gactccatctctctcgccaacaccttcgacgagctcaacatcgactccctcgacaagatc aacatctccttcgaggtcgaagaggccttcaacatcgagattcccgacgaagccctcagc accctccgcaccgtaggcgacatggtcgagggcgtcgccaaactcaccaccgcccccgcc cacatcaccaccccctaa

DBGET integrated database retrieval system