KEGG   Tunturiibacter gelidiferens: RBB81_12325
Entry
RBB81_12325       CDS       T10211                                 
Symbol
truB
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
tgi  Tunturiibacter gelidiferens
Brite
KEGG Orthology (KO) [BR:tgi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tgi03016]
    RBB81_12325 (truB)
Enzymes [BR:tgi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     RBB81_12325 (truB)
Transfer RNA biogenesis [BR:tgi03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    RBB81_12325 (truB)
 Prokaryotic type
    RBB81_12325 (truB)
SSDB
Motif
Pfam: TruB_N TruB_C_2 DKCLD Bac_luciferase TruB-C_2 AsmA
Other DBs
NCBI-ProteinID: XCB20395
UniProt: A0AAU7YVD3
LinkDB
Position
2770177..2771049
AA seq 290 aa
MNGLLVLDKPSGITSHDVVAIVRRATGEKSIGHLGTLDPMATGVLPLLLGKYTRLAQFFG
QADKHYTGRIRFGFATDSFDADGMPAGETLPLRLTLEKLRTLSQRFRGELDQVPPIFSAK
KINGVAAHKLARAGAEVAVKPARITIHNFELTSLEGDTASFVMSVSAGGYVRSVAHELGQ
LANCGAHLSSLRRTRAGAFSLEHSITIDQLKTASVAELEGMLPHPRTLLPEMPSVTVDDQ
LAGRLRNGMQVNLPDFSQAPLVKVFTTPTDLLAITRRIAGTLMQPIVVLG
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaatggtctccttgtactcgataaaccctccggcattacatcgcatgacgtcgtcgcc
atcgttcgccgggccactggcgaaaagtccattggccacctcggcacgctggacccaatg
gccaccggcgttctgccgctgcttctcggcaaatacacgcgcctcgcgcagttcttcggc
caagcagacaagcactacacaggccgcatccgcttcggcttcgccaccgatagcttcgac
gcagacggaatgcctgcgggcgaaacgcttcccctgcgcctgacccttgaaaagctgcga
acactaagtcaaagatttcgcggggagttagaccaggtccccccgatcttctccgcgaag
aagatcaacggagtcgctgcccataagctggcgcgagcaggcgccgaggtcgcggtcaaa
ccggcgcgcatcacgattcacaacttcgagctaacctccctcgaaggcgacacggcatct
ttcgtcatgtccgtctccgccggtggctatgtgcgttccgtagcccacgagctcgggcaa
ttggcgaactgtggtgcgcatctttccagtctgcgaaggacccgtgccggagcattctcc
ctcgaacactcgatcaccatcgaccagctcaagacagcctcggtcgccgaacttgagggg
atgctgccgcacccgcgcacgctgctccccgagatgccgtccgttaccgtggacgatcag
cttgccggtcgattgcgaaacggaatgcaggtcaatctccccgatttctcgcaggcacct
ctggttaaagtattcactactccaacagatttattggcaatcacgcgccgtatcgccggc
acgttgatgcaacccatcgtcgtcctcgggtag

DBGET integrated database retrieval system