Thalassovita gelatinovora: HFZ77_03195 Help Entry HFZ77_03195       CDS       T06533                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tgl  Thalassovita gelatinovora Pathway tgl01100   Metabolic pathways tgl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tgl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HFZ77_03195    00074 Mycolic acid biosynthesis     HFZ77_03195   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HFZ77_03195 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  QIZ79552 LinkDB All DBs Position complement(675151..675384) Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVEEDKVTENASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISQAS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgcagaccgcgtcaaaaaaatcgttgttgagcacctgggtgtggaagaa gacaaagtcaccgagaacgcttcgttcatcgacgacctgggcgcggacagcctggacacc gtagaattggtgatggcgttcgaagaagaattcggcatcgagattcccgatgacgccgcc gaaacgattcagacttttggcgacgcagtgaagttcatcagccaagcgtcgtaa

DBGET integrated database retrieval system