Thalassovita gelatinovora: HFZ77_04715
Help
Entry
HFZ77_04715 CDS
T06533
Name
(GenBank) NADH-quinone oxidoreductase subunit J
KO
K00339
NADH-quinone oxidoreductase subunit J [EC:
7.1.1.2
]
Organism
tgl
Thalassovita gelatinovora
Pathway
tgl00190
Oxidative phosphorylation
tgl01100
Metabolic pathways
Module
tgl_M00144
NADH:quinone oxidoreductase, prokaryotes
Brite
KEGG Orthology (KO) [BR:
tgl00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
HFZ77_04715
Enzymes [BR:
tgl01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.2 NADH:ubiquinone reductase (H+-translocating)
HFZ77_04715
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Oxidored_q3
Motif
Other DBs
NCBI-ProteinID:
QIZ79833
LinkDB
All DBs
Position
complement(974978..975586)
Genome browser
AA seq
202 aa
AA seq
DB search
MTIAALAFYLFAICAIAGGLFTVISRNPVHSVLWLILAFLSSAGLFVLLGAEFVAMLLII
VYVGAVMVLFLFVVMMLDVDFAELKAEMAKYLPLALLIGVVLLMQFAMAYGAWDYAEHAA
DARAAVTPEGVENTAALGQLIYDKYFLLFQLAGLILLVAMIGAIVLTLRHRSNIKRQNVL
HQMWRDPAKAMELKDVKPGQGL
NT seq
609 nt
NT seq
+upstream
nt +downstream
nt
atgacgattgcagcgctggcattctatctgttcgcgatctgcgccatcgccggggggctg
ttcactgtgatcagccgcaatccggtgcattcggtgctgtggctgatcctggccttcctg
tcttcggcggggctgttcgtgttgctgggggcggaattcgtcgccatgcttttgatcatt
gtctatgtcggggcggtcatggtgctgttcctgttcgtggtgatgatgctggatgtcgat
ttcgccgaactgaaggcggaaatggcgaaataccttcccttggcgctgctgatcggggtg
gtcttgctgatgcaattcgccatggcttacggcgcttgggattacgcggaacacgccgct
gatgcgcgcgctgcggtcacgcccgaaggggtggaaaacaccgccgccctggggcagctg
atctatgacaaatacttccttttgttccaactggccgggttgatcctgctggtggcgatg
atcggcgcgattgtgctgacgctgcgccatcgcagcaatatcaagcgccagaacgtgctg
catcaaatgtggcgcgatccggccaaggcgatggaattgaaggacgtgaaaccggggcag
gggttgtga
DBGET
integrated database retrieval system