Thalassovita gelatinovora: HFZ77_16960 Help Entry HFZ77_16960       CDS       T06533                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tgl  Thalassovita gelatinovora Pathway tgl01100   Metabolic pathways tgl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tgl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HFZ77_16960    00074 Mycolic acid biosynthesis     HFZ77_16960   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HFZ77_16960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QIZ82047 LinkDB All DBs Position 3476464..3476709 Genome browser AA seq 81 aa AA seqDB search MTQDELRTAFLEELTSVAPDIAAEDVGGNDHLQDDLELDSMDVLNLVTALHERLGVDIPE ADYTRIETLDKAVAYLAERLG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacccaagacgaactgcgaaccgcctttctcgaagaattgacctcggtcgcgcccgat attgccgccgaagatgtcggcggcaacgatcaccttcaggacgatctggaactcgattcc atggatgtgctcaatctggtcacggcgctgcatgaacggctgggggtggacattcccgaa gccgattacacaaggatcgaaacgctggacaaggcggtggcctatctggccgaacggctg ggttga

DBGET integrated database retrieval system