Thioalkalivibrio sulfidiphilus: Tgr7_0762 Help Entry Tgr7_0762         CDS       T00840                                  Name (GenBank) cell division protein FtsL   KO K03586   cell division protein FtsL Organism tgr  Thioalkalivibrio sulfidiphilus Brite KEGG Orthology (KO) [BR:tgr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tgr03036]     Tgr7_0762 Chromosome and associated proteins [BR:tgr03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     Tgr7_0762 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FtsL DivIC Motif Other DBs NCBI-ProteinID:  ACL71854 UniProt:  B8GMM2 LinkDB All DBs Position 817944..818213 Genome browser AA seq 89 aa AA seqDB search MRLRLVGFGVLFLAVLISAFGVIYSKHHSRSLFMALQVELAERDSLNVEWGQLQLEQSTW ATHGRIEETARQRLNMTLPNAGNTVILLD NT seq 270 nt NT seq  +upstreamnt  +downstreamnt gtgaggctgcgcctggtggggttcggggtgctgttcctggcggtgctgatcagcgccttc ggggtgatctacagcaagcaccacagccgcagcctgttcatggcgctgcaggtggagctg gctgaacgggacagcctgaacgtggagtggggccagctgcagctggaacagagcacctgg gccacccacggacgtatcgaagagacggcgcggcagcgcttgaacatgaccctgccgaac gccggcaacaccgtgattctgttggattga

DBGET integrated database retrieval system