Thioalkalivibrio sulfidiphilus: Tgr7_1834 Help Entry Tgr7_1834         CDS       T00840                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism tgr  Thioalkalivibrio sulfidiphilus Pathway tgr01100   Metabolic pathways tgr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:tgr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Tgr7_1834    00074 Mycolic acid biosynthesis     Tgr7_1834   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Tgr7_1834 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ACL72915 UniProt:  B8GSL1 LinkDB All DBs Position complement(1947112..1947351) Genome browser AA seq 79 aa AA seqDB search MSNIEERVKKIVVEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQQAIDYINAHAQG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaacattgaagaacgcgtcaagaaaatcgttgtggaacagctgggcgtgaaggaa gaagaagtcaccaacagcgcttccttcgtcgaagatctgggcgcggattctctggacacc gtggaactcgtcatggccctcgaagaagaattcgagaccgaaattcctgacgaggaagcg gaaaagatcaccaccgtgcagcaggcgattgattacatcaacgcccacgctcagggttga

DBGET integrated database retrieval system