Taeniopygia guttata (zebra finch): 100189942 Help Entry 100189942         CDS       T01082                                  Symbol ATG12 Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism tgu  Taeniopygia guttata (zebra finch) Pathway tgu04068   FoxO signaling pathway tgu04136   Autophagy - other tgu04140   Autophagy - animal tgu04621   NOD-like receptor signaling pathway tgu04622   RIG-I-like receptor signaling pathway Brite KEGG Orthology (KO) [BR:tgu00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     100189942 (ATG12)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100189942 (ATG12)    04136 Autophagy - other     100189942 (ATG12)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100189942 (ATG12)    04622 RIG-I-like receptor signaling pathway     100189942 (ATG12)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tgu04131]     100189942 (ATG12)    04121 Ubiquitin system [BR:tgu04121]     100189942 (ATG12)    03029 Mitochondrial biogenesis [BR:tgu03029]     100189942 (ATG12) Membrane trafficking [BR:tgu04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     100189942 (ATG12) Ubiquitin system [BR:tgu04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    100189942 (ATG12) Mitochondrial biogenesis [BR:tgu03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     100189942 (ATG12) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 ATG8 Motif Other DBs NCBI-GeneID:  100189942 NCBI-ProteinID:  NP_001232734 UniProt:  B5FX55 LinkDB All DBs Position Z:29636141..29641613 Genome browser AA seq 143 aa AA seqDB search MAEPGERPPPAAPHGGGRSDGAEEAQEGGAPAGPAEPGPPPAGSPGSEEPAGDARKKIDV LLKAVGDTPIMRTKKWAVERTRTIQGLVEFIKKFLKLMASEQLFIYVNQSFAPSPDQEVG TLYECFGSDGKLVLHYCKTQAWG NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atggcggagcccggggagcggccgcctcccgccgcgccgcacggcggcggccggagcgac ggcgcggaggaggcacaggaaggcggtgctccggcggggcccgccgaaccgggcccgccc ccggccgggtcgccgggctctgaggagcccgcgggcgacgcaagaaagaaaattgatgtg ctgctgaaggccgtgggcgacacccccatcatgaggaccaagaagtgggcggtggagcgg acccggaccatccagggcctcgtggagttcataaagaagttcctcaagctgatggcctcc gaacagctgttcatatatgtaaaccagtcttttgctccatctccagaccaagaagtgggg accctctatgagtgttttggaagtgatggcaagcttgtactgcattactgcaaaactcag gcatggggatga

DBGET integrated database retrieval system