Taeniopygia guttata (zebra finch): 100190361 Help Entry 100190361         CDS       T01082                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism tgu  Taeniopygia guttata (zebra finch) Pathway tgu04010   MAPK signaling pathway tgu04012   ErbB signaling pathway tgu04068   FoxO signaling pathway tgu04137   Mitophagy - animal tgu04140   Autophagy - animal tgu04144   Endocytosis tgu04150   mTOR signaling pathway tgu04210   Apoptosis tgu04218   Cellular senescence tgu04370   VEGF signaling pathway tgu04371   Apelin signaling pathway tgu04510   Focal adhesion tgu04540   Gap junction tgu04625   C-type lectin receptor signaling pathway tgu04810   Regulation of actin cytoskeleton tgu04910   Insulin signaling pathway tgu04912   GnRH signaling pathway tgu04916   Melanogenesis tgu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tgu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100190361 (HRAS)    04012 ErbB signaling pathway     100190361 (HRAS)    04370 VEGF signaling pathway     100190361 (HRAS)    04371 Apelin signaling pathway     100190361 (HRAS)    04068 FoxO signaling pathway     100190361 (HRAS)    04150 mTOR signaling pathway     100190361 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100190361 (HRAS)    04140 Autophagy - animal     100190361 (HRAS)    04137 Mitophagy - animal     100190361 (HRAS)   09143 Cell growth and death    04210 Apoptosis     100190361 (HRAS)    04218 Cellular senescence     100190361 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100190361 (HRAS)    04540 Gap junction     100190361 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100190361 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100190361 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     100190361 (HRAS)    04912 GnRH signaling pathway     100190361 (HRAS)    04916 Melanogenesis     100190361 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100190361 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tgu04131]     100190361 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tgu04147]     100190361 (HRAS)    04031 GTP-binding proteins [BR:tgu04031]     100190361 (HRAS) Membrane trafficking [BR:tgu04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     100190361 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     100190361 (HRAS) Exosome [BR:tgu04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    100190361 (HRAS)   Exosomal proteins of colorectal cancer cells    100190361 (HRAS) GTP-binding proteins [BR:tgu04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     100190361 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  100190361 NCBI-ProteinID:  NP_001232482 Ensembl:  ENSTGUG00000009877 UniProt:  B5G0X7 LinkDB All DBs Position 5:17749869..17789699 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgaatacaagctggtggtggtgggagcaggtggtgttgggaagagtgctttgaca atacagctcattcagaaccattttgtggatgaatatgaccccacgatagaggattcctac agaaagcaagtagtcattgatggagagacctgtttgttagacattttggacaccgcaggg caggaggagtatagtgccatgagagaccagtacatgagaacaggggaaggattcctgtgt gtcttcgccatcaacaacaccaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtggggaataaatgtgacctc cctgcgcggacagtggagacccggcaagcgcaggacctggcccggagctacgggatcccc tacatagaaacgtctgccaaaaccagacagggcgttgaggatgccttctacaccttggtg cgggagatccggcagcataagctgcgcaagctgaatcccccggatgagagcggccccggc tgcatgaactgtaaatgtgtggtatcgtga

DBGET integrated database retrieval system