Taeniopygia guttata (zebra finch): 100190366 Help Entry 100190366         CDS       T01082                                  Symbol TXN Name (RefSeq) thioredoxin   KO K03671   thioredoxin Organism tgu  Taeniopygia guttata (zebra finch) Pathway tgu04621   NOD-like receptor signaling pathway tgu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tgu00001]  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100190366 (TXN)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100190366 (TXN)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:tgu03110]     100190366 (TXN) Chaperones and folding catalysts [BR:tgu03110]  Protein folding catalysts   Protein disulfide isomerase    100190366 (TXN) SSDB OrthologParalogGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 OST3_OST6 Glutaredoxin AhpC-TSA DIM1 Thioredoxin_9 Thioredoxin_7 Redoxin A6-like_Thioredoxin-like_C Motif Other DBs NCBI-GeneID:  100190366 NCBI-ProteinID:  NP_001232496 Ensembl:  ENSTGUG00000001294 UniProt:  B5G117 LinkDB All DBs Position Z:complement(31476301..31485479) Genome browser AA seq 105 aa AA seqDB search MVKIVGNLVEFEAELKSAGEKLIVVDFSATWCGPCKMIKPFFHSLSEKYSEVIFIEIDVD DAQDVASHCDVKCMPTFQFYKNGNKVQEFSGANKEKLEETIKSLV NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggtgaagatcgtgggcaacctggttgaatttgaggcagaactgaaaagtgctggtgaa aagcttatagtagttgatttctctgccacatggtgtggaccatgcaaaatgatcaagccc ttttttcacagtttgtctgagaagtatagtgaagtgatattcatagaaatcgatgtggat gatgcccaggatgttgcttcacactgtgatgtgaagtgcatgccaacgttccagttctac aagaatggaaataaggtgcaggagttctctggggccaataaagagaagctggaagagacc attaaaagtctagtctaa

DBGET integrated database retrieval system