Taeniopygia guttata (zebra finch): 100190386 Help Entry 100190386         CDS       T01082                                  Symbol RHOA Name (RefSeq) transforming protein RhoA   KO K04513   Ras homolog gene family, member A Organism tgu  Taeniopygia guttata (zebra finch) Pathway tgu04081   Hormone signaling tgu04144   Endocytosis tgu04150   mTOR signaling pathway tgu04270   Vascular smooth muscle contraction tgu04310   Wnt signaling pathway tgu04350   TGF-beta signaling pathway tgu04510   Focal adhesion tgu04517   IgSF CAM signaling tgu04519   Cadherin signaling tgu04520   Adherens junction tgu04530   Tight junction tgu04621   NOD-like receptor signaling pathway tgu04625   C-type lectin receptor signaling pathway tgu04810   Regulation of actin cytoskeleton tgu05100   Bacterial invasion of epithelial cells tgu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tgu00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     100190386 (RHOA)    04350 TGF-beta signaling pathway     100190386 (RHOA)    04150 mTOR signaling pathway     100190386 (RHOA)   09133 Signaling molecules and interaction    04081 Hormone signaling     100190386 (RHOA)    04517 IgSF CAM signaling     100190386 (RHOA)    04519 Cadherin signaling     100190386 (RHOA)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100190386 (RHOA)   09144 Cellular community - eukaryotes    04510 Focal adhesion     100190386 (RHOA)    04520 Adherens junction     100190386 (RHOA)    04530 Tight junction     100190386 (RHOA)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100190386 (RHOA)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     100190386 (RHOA)    04625 C-type lectin receptor signaling pathway     100190386 (RHOA)   09153 Circulatory system    04270 Vascular smooth muscle contraction     100190386 (RHOA)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100190386 (RHOA)    05100 Bacterial invasion of epithelial cells     100190386 (RHOA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tgu04131]     100190386 (RHOA)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tgu04147]     100190386 (RHOA)    04031 GTP-binding proteins [BR:tgu04031]     100190386 (RHOA) Membrane trafficking [BR:tgu04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     100190386 (RHOA) Exosome [BR:tgu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100190386 (RHOA)   Exosomal proteins of other body fluids (saliva and urine)    100190386 (RHOA)   Exosomal proteins of colorectal cancer cells    100190386 (RHOA)   Exosomal proteins of bladder cancer cells    100190386 (RHOA) GTP-binding proteins [BR:tgu04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     100190386 (RHOA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Gtr1_RagA SRPRB VASP_tetra Motif Other DBs NCBI-GeneID:  100190386 NCBI-ProteinID:  NP_001232551 UniProt:  B5G1B5 LinkDB All DBs Position 12:complement(13794592..13817301) Genome browser AA seq 193 aa AA seqDB search MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLQNIPEKWTPEVKHFCPNVPIILVGNKKD LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ ARRGKKKSGCLFL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggcagccattcgaaaaaagctggttatagtgggagatggtgcctgtggaaagacctgt ctgctgattgtatttagcaaagaccagttccctgaagtgtatgttcccactgtctttgaa aattacgtagcagatattgaagtggatggaaagcaggttgagttggctttgtgggataca gcaggacaggaagactacgatcgacttagaccgctttcttatccagatactgatgttata cttatgtgtttttcaattgatagtcctgatagtttacaaaacatcccagagaagtggacc ccggaggtgaagcatttctgccccaacgtgcctatcatcttggtaggaaacaagaaggac ctgaggaatgacgagcacacaagacgagagctggccaaaatgaagcaggagcctgtcaaa cccgaggagggccgggatatggcaaaccgcattggtgcatttggctacatggagtgttcg gcaaagaccaaagacggtgtgagggaggtgtttgaaatggccactagagctgctttgcaa gcccggcgtggcaagaagaagtccgggtgcctcttcttataa

DBGET integrated database retrieval system