Taeniopygia guttata (zebra finch): 100190486 Help Entry 100190486         CDS       T01082                                  Symbol DCTN3 Name (RefSeq) dynactin subunit 3   KO K10425   dynactin 3 Organism tgu  Taeniopygia guttata (zebra finch) Pathway tgu04145   Phagocytosis tgu04814   Motor proteins tgu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tgu00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     100190486 (DCTN3)   09142 Cell motility    04814 Motor proteins     100190486 (DCTN3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100190486 (DCTN3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:tgu03036]     100190486 (DCTN3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:tgu04812]     100190486 (DCTN3) Chromosome and associated proteins [BR:tgu03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Dynactin complex      100190486 (DCTN3) Cytoskeleton proteins [BR:tgu04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dynactins      100190486 (DCTN3) SSDB OrthologParalogGFIT Motif Pfam:  Dynactin_p22 Motif Other DBs NCBI-GeneID:  100190486 NCBI-ProteinID:  NP_001232120 UniProt:  B5G3H3 B5G3H6 LinkDB All DBs Position Z:complement(43564547..43568469) Genome browser AA seq 57 aa AA seqDB search MAAGAAELRRLQWRLEELEQRVGLGGCGPQKVADELVKVQVALNNIAGKRERIKXPV NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atggcggcgggcgctgcggagctgcggcggctgcagtggcggctggaagagctggaacaa cgcgtcggcctcggcggctgcgggccgcaaaaggtggcggacgagctggtgaaggtgcag gtggcgctgaacaatatcgccggcaagagggagaggatcaaaatncctgtttaa

DBGET integrated database retrieval system