Taeniopygia guttata (zebra finch): 100223328 Help Entry 100223328         CDS       T01082                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism tgu  Taeniopygia guttata (zebra finch) Pathway tgu04060   Cytokine-cytokine receptor interaction tgu04218   Cellular senescence tgu04620   Toll-like receptor signaling pathway tgu04621   NOD-like receptor signaling pathway tgu04622   RIG-I-like receptor signaling pathway tgu05132   Salmonella infection tgu05164   Influenza A Brite KEGG Orthology (KO) [BR:tgu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100223328  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     100223328  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100223328    04621 NOD-like receptor signaling pathway     100223328    04622 RIG-I-like receptor signaling pathway     100223328  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     100223328   09171 Infectious disease: bacterial    05132 Salmonella infection     100223328  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tgu04052]     100223328    00536 Glycosaminoglycan binding proteins [BR:tgu00536]     100223328 Cytokines and neuropeptides [BR:tgu04052]  Cytokines   Chemokines    100223328 Glycosaminoglycan binding proteins [BR:tgu00536]  Heparan sulfate / Heparin   Chemokines    100223328 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  100223328 NCBI-ProteinID:  XP_002192050 Ensembl:  ENSTGUG00000001542 LinkDB All DBs Position 4:complement(67786351..67788859) Genome browser AA seq 104 aa AA seqDB search MMGKTVAAVLTLLLISALGTQGEVVPRSAIELRCQCINTHSKFIHPKFIQNVNLTPSGPH CKNVEVIATLRDGREVCLEPSAPWVKLIIKTILDKANTKPETVY NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgatgggcaagactgtggctgctgtcctgaccctgctcctgatctcagcgcttggaaca caaggtgaggtggtgccacgttcagccattgaactccggtgtcagtgcataaacacccat tccaaattcatccatcccaagttcatccaaaatgtgaacctcacccccagtggacctcac tgcaagaatgttgaagtcatagctaccctgcgagatggcagagaagtgtgcctggagccc agtgctccctgggtgaagcttatcatcaagacaattctggacaaggccaacaccaaacct gagacagtgtactaa

DBGET integrated database retrieval system