Taeniopygia guttata (zebra finch): 100229058 Help Entry 100229058         CDS       T01082                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism tgu  Taeniopygia guttata (zebra finch) Pathway tgu04010   MAPK signaling pathway tgu04020   Calcium signaling pathway tgu04114   Oocyte meiosis tgu04218   Cellular senescence tgu04310   Wnt signaling pathway tgu04370   VEGF signaling pathway tgu04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:tgu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100229058 (PPP3R1)    04310 Wnt signaling pathway     100229058 (PPP3R1)    04370 VEGF signaling pathway     100229058 (PPP3R1)    04020 Calcium signaling pathway     100229058 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     100229058 (PPP3R1)    04218 Cellular senescence     100229058 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     100229058 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:tgu01009]     100229058 (PPP3R1) Protein phosphatases and associated proteins [BR:tgu01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100229058 (PPP3R1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EH SPARC_Ca_bdg EF-hand_9 Motif Other DBs NCBI-GeneID:  100229058 NCBI-ProteinID:  XP_002199881 Ensembl:  ENSTGUG00000018231 LinkDB All DBs Position 3:108219876..108257938 Genome browser AA seq 170 aa AA seqDB search MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaggcaagctaccctttggaaatgtgctcgcactttgatgctgatgagata aaaagactaggaaagagatttaagaagcttgatttggacaactctggttctctgagcgtg gaagagttcatgtctttacctgaattgcaacagaacccgttagtacagcgagtaatagat atatttgacacagatggcaatggagaagtggattttaaagagtttatagaaggagtctcc cagttcagtgtcaaaggagataaagaacagaagttgaggtttgcttttcgcatttatgat atggacaaagatggctatatctcaaatggagagctcttccaggtgctgaagatgatggtt gggaacaatctcaaagacactcagttacagcaaattgtagataaaaccataattaatgca gataaggatggtgatggaagaatatcctttgaagaattttgtgctgttgtaggaggccta gatatccacaaaaagatggtcgtagatgtgtga

DBGET integrated database retrieval system