Taeniopygia guttata (zebra finch): 100231606 Help Entry 100231606         CDS       T01082                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism tgu  Taeniopygia guttata (zebra finch) Pathway tgu04010   MAPK signaling pathway tgu04068   FoxO signaling pathway tgu04081   Hormone signaling tgu04114   Oocyte meiosis tgu04140   Autophagy - animal tgu04150   mTOR signaling pathway tgu04810   Regulation of actin cytoskeleton tgu04910   Insulin signaling pathway tgu04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:tgu00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100231606 (INS)    04068 FoxO signaling pathway     100231606 (INS)    04150 mTOR signaling pathway     100231606 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     100231606 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     100231606 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     100231606 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     100231606 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     100231606 (INS)    04914 Progesterone-mediated oocyte maturation     100231606 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tgu04052]     100231606 (INS) Cytokines and neuropeptides [BR:tgu04052]  Neuropeptides   Unclassified    100231606 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  100231606 NCBI-ProteinID:  XP_002198969 Ensembl:  ENSTGUG00000009326 UniProt:  H0ZG98 LinkDB All DBs Position 5:15372309..15375630 Genome browser AA seq 137 aa AA seqDB search MGTLLPTIFIPQSELLSISCCHLLGLSLSTMALWIRSLPLLALLAVSGPGSSHGAVNQHL CGSHLVEALYLVCGERGFFYQPKARRDVEQPLVSGPLHGELGELPFQQEEFETVKRGIVE QCCHNTCSLYQLENYCN NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atggggacattactaccaaccatcttcatccctcagagtgaacttctctccatctcttgc tgccacctcttgggcctcagcctgtccaccatggctctctggatccgatcactgcctctc ctggccctcctggctgtctccggccccgggagcagccacggggctgtcaaccagcacctc tgcggctcccacttggtggaagctctgtacctggtgtgcggggagaggggcttcttctac caacccaaagcccggcgggatgttgagcagcctctagtgagtggtcccttgcatggtgag ctgggagagctgcccttccagcaggaggagtttgagacggtgaagcgagggatcgttgag caatgctgccacaacacctgctccctctaccagctggaaaactactgcaattag

DBGET integrated database retrieval system