Taeniopygia guttata (zebra finch): 100231734 Help Entry 100231734         CDS       T01082                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism tgu  Taeniopygia guttata (zebra finch) Pathway tgu04137   Mitophagy - animal tgu04140   Autophagy - animal tgu04144   Endocytosis tgu04145   Phagosome tgu04148   Efferocytosis tgu05132   Salmonella infection Brite KEGG Orthology (KO) [BR:tgu00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     100231734 (RAB7A)    04145 Phagosome     100231734 (RAB7A)    04140 Autophagy - animal     100231734 (RAB7A)    04137 Mitophagy - animal     100231734 (RAB7A)    04148 Efferocytosis     100231734 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     100231734 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:tgu04131]     100231734 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tgu04147]     100231734 (RAB7A)    04031 GTP-binding proteins [BR:tgu04031]     100231734 (RAB7A) Membrane trafficking [BR:tgu04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     100231734 (RAB7A) Exosome [BR:tgu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    100231734 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    100231734 (RAB7A)   Exosomal proteins of colorectal cancer cells    100231734 (RAB7A)   Exosomal proteins of bladder cancer cells    100231734 (RAB7A) GTP-binding proteins [BR:tgu04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     100231734 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC FLYWCH_N ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  100231734 NCBI-ProteinID:  XP_030139297 Ensembl:  ENSTGUG00000007832 UniProt:  A0A674HJY3 LinkDB All DBs Position 12:11469201..11489685 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKTDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatccttggagactctggggtggga aagacatcactcatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggctacg ataggtgcagacttcctgacaaaagaggtgatggtggatgacaggctagtgacaatgcag atatgggatacagcaggccaagaacgatttcagtctctgggagttgccttctacagggga gcagattgctgtgtgctggtatttgatgtcacggctcccaacacgttcaaaaccctagac agctggagggatgaattcctcattcaggccagtccaagggatcctgagaattttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcacaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aatgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg gaactttacaatgaattccccgaacccatcaaactagacaagactgaccgagcaaaggct tctgcggagagctgcagctgctga

DBGET integrated database retrieval system