Taeniopygia guttata (zebra finch): 100232180 Help Entry 100232180         CDS       T01082                                  Symbol NPY Name (RefSeq) pro-neuropeptide Y   KO K05232   neuropeptide Y Organism tgu  Taeniopygia guttata (zebra finch) Pathway tgu04080   Neuroactive ligand-receptor interaction tgu04920   Adipocytokine signaling pathway Brite KEGG Orthology (KO) [BR:tgu00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     100232180 (NPY)  09150 Organismal Systems   09152 Endocrine system    04920 Adipocytokine signaling pathway     100232180 (NPY)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:tgu04052]     100232180 (NPY) Cytokines and neuropeptides [BR:tgu04052]  Neuropeptides   GPCR binding    100232180 (NPY) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hormone_3 Motif Other DBs NCBI-GeneID:  100232180 NCBI-ProteinID:  XP_030120707 UniProt:  A0A674H9L3 LinkDB All DBs Position 2:32192444..32201637 Genome browser AA seq 97 aa AA seqDB search MQGTVRLWVSVLTFALSLLVCLGTLAEAYPSKPDSPGEDAPAEDMARYYSALRHYINLIT RQRYGKRSSPDTLISDLLLRESTENIPRSRFEDPSMW NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgcagggcaccgtgaggctgtgggtgtccgtgctgactttcgccctgtcgctgctggtc tgcctggggacgctggcagaggcgtacccctccaaaccggacagccccggcgaggacgcc cccgcagaggacatggccagatactactcggcgctgaggcactacatcaacctcatcacc aggcagagatatggaaagagatcaagcccagatacactgatctcagacctcttgttgagg gaaagcacagaaaacattcctagatccaggtttgaagacccttcgatgtggtga

DBGET integrated database retrieval system