Thermococcus guaymasensis: X802_03095 Help Entry X802_03095        CDS       T04184                                  Name (GenBank) ribonuclease P   KO K03538   ribonuclease P protein subunit POP4 [EC:3.1.26.5] Organism tgy  Thermococcus guaymasensis Pathway tgy03008   Ribosome biogenesis in eukaryotes Brite KEGG Orthology (KO) [BR:tgy00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     X802_03095  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:tgy03009]     X802_03095    03016 Transfer RNA biogenesis [BR:tgy03016]     X802_03095    03029 Mitochondrial biogenesis [BR:tgy03029]     X802_03095 Enzymes [BR:tgy01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.26  Endoribonucleases producing 5'-phosphomonoesters     3.1.26.5  ribonuclease P      X802_03095 Ribosome biogenesis [BR:tgy03009]  Eukaryotic type   Pre-60S particles    RNases     RNase MRP      X802_03095 Transfer RNA biogenesis [BR:tgy03016]  Eukaryotic type   5'processing factors    Ribonucrease P     X802_03095 Mitochondrial biogenesis [BR:tgy03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    RNase MRP     X802_03095 SSDB OrthologParalogGFIT Motif Pfam:  RNase_P-MRP_p29 Vsr Motif Other DBs NCBI-ProteinID:  AJC71265 UniProt:  A0A0X1KJ39 LinkDB All DBs Position complement(535670..535939) Genome browser AA seq 89 aa AA seqDB search MTRKNIIWHELIGLKAKIIRASHPELVGIEGYVLDETRNTLTIVGDRVWTVPKDVVEVEF ETAAGEKIRVDGKSLVGRPEMRLKKRWRK NT seq 270 nt NT seq  +upstreamnt  +downstreamnt gtgacgcggaagaacataatctggcacgagctcataggcctcaaagcaaagattataagg gcatctcatccagagctggtcggcatcgagggctacgtccttgatgaaacccgtaacact ctcacaatagttggtgatagggtctggaccgttcctaaggacgtggtcgaggtcgagttt gaaacggccgccggcgaaaagattagggttgatggaaagagcttagtgggaagacctgag atgagattgaagaagaggtggcggaaatga

DBGET integrated database retrieval system