Thermococcus guaymasensis: X802_06485 Help Entry X802_06485        CDS       T04184                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism tgy  Thermococcus guaymasensis Pathway tgy03010   Ribosome Brite KEGG Orthology (KO) [BR:tgy00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     X802_06485   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     X802_06485  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:tgy03011]     X802_06485    04121 Ubiquitin system [BR:tgy04121]     X802_06485   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:tgy04147]     X802_06485 Ribosome [BR:tgy03011]  Ribosomal proteins   Eukaryotes    Small subunit     X802_06485   Archaea     X802_06485 Ubiquitin system [BR:tgy04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    X802_06485 Exosome [BR:tgy04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    X802_06485   Exosomal proteins of colorectal cancer cells    X802_06485 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Cas12f1-like_TNB Zn_ribbon_IS1595 Zn_ribbon_NUD Zn_Ribbon_TF GFA MqsA_antitoxin Zn_ribbon_RPB9 Zn_Ribbon_1 Motif Other DBs NCBI-ProteinID:  AJC71845 UniProt:  A0A0X1KKT2 LinkDB All DBs Position 1144398..1144571 Genome browser AA seq 57 aa AA seqDB search MAKGKKKTSQKWKLYEVKGGKVIRKNKFCPRCGPGVFMADHGDRWSCGRCGYTEWKK NT seq 174 nt NT seq  +upstreamnt  +downstreamnt atggccaagggtaagaagaagaccagccagaagtggaagctctacgaggttaagggcggg aaggtcatcaggaagaacaagttctgcccgcgctgtgggccgggcgttttcatggctgac cacggcgaccgctggagctgcggaaggtgcggctacaccgagtggaagaagtga

DBGET integrated database retrieval system