Thermococcus guaymasensis: X802_09870 Help Entry X802_09870        CDS       T04184                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism tgy  Thermococcus guaymasensis Pathway tgy00362   Benzoate degradation tgy01100   Metabolic pathways tgy01120   Microbial metabolism in diverse environments tgy01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:tgy00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     X802_09870    00622 Xylene degradation     X802_09870    00621 Dioxin degradation     X802_09870 Enzymes [BR:tgy01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      X802_09870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Motif Other DBs NCBI-ProteinID:  AJC72420 UniProt:  A0A0X1KMF3 LinkDB All DBs Position 1730137..1730331 Genome browser AA seq 64 aa AA seqDB search MPTVIIEGPKADAEIKRELVRRITEVVREVYKVHHVSVIIHENEPENVGVDGELLSDVIA RRKG NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgccgacggtgataattgaaggccctaaagccgatgctgagatcaagagggagctcgtg aggaggataaccgaggtagttagggaagtctacaaggtacaccacgtgagcgtgataatc cacgagaatgagcctgaaaacgttggcgttgatggggagctcctctccgatgtgatagca aggagaaaggggtag

DBGET integrated database retrieval system