Thalassococcus sp. S3: CFI11_00855 Help Entry CFI11_00855       CDS       T05844                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism thaa  Thalassococcus sp. S3 Brite KEGG Orthology (KO) [BR:thaa00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:thaa03032]     CFI11_00855    03036 Chromosome and associated proteins [BR:thaa03036]     CFI11_00855    03400 DNA repair and recombination proteins [BR:thaa03400]     CFI11_00855 DNA replication proteins [BR:thaa03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CFI11_00855 Chromosome and associated proteins [BR:thaa03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CFI11_00855 DNA repair and recombination proteins [BR:thaa03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CFI11_00855 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_euk_2 HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  QBF29766 UniProt:  A0A4P6MBP1 LinkDB All DBs Position 163540..163827 Genome browser AA seq 95 aa AA seqDB search MAKPMTKTQLVAALAEEMGTDKKGASAALDAMTSLITREVAAGGAVTLPGVGKIYCRERP ERMVRNPATGEQFKKEADKVVKMTIAKALKDSVNG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggcaaaacccatgaccaaaacccaactcgtcgccgcactggccgaagaaatgggcacg gacaagaaaggcgcaagcgcagcgcttgatgcaatgacctcgctgatcacccgcgaagtg gcagctggcggcgcggtaaccctgccgggcgttggcaagatctattgccgcgaacgcccc gagcgtatggttcgcaacccggccaccggtgagcagttcaagaaggaagcggacaaggtg gtcaaaatgaccattgccaaagcgctgaaggacagcgtgaacggctga

DBGET integrated database retrieval system