Thalassococcus sp. S3: CFI11_01910 Help Entry CFI11_01910       CDS       T05844                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism thaa  Thalassococcus sp. S3 Pathway thaa00190   Oxidative phosphorylation thaa01100   Metabolic pathways Module thaa_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:thaa00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     CFI11_01910  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:thaa00194]     CFI11_01910 Photosynthesis proteins [BR:thaa00194]  Photosystem and electron transport system   F-type ATPase [OT]    CFI11_01910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QBF29978 UniProt:  A0A4P6MAN6 LinkDB All DBs Position 377960..378196 Genome browser AA seq 78 aa AA seqDB search MEGDIAQMGQFIGAGLAAIGSGAAAIGVGHVAGNFLAGALRNPSAAASQTATLFIGIAFA EALGIFAFLVSLLLMFAV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaaggcgatatcgcacaaatgggtcaattcatcggcgcaggcctggccgctatcggt tccggcgccgctgctatcggtgtgggccacgtggccggcaacttcctggccggtgccctg cgcaacccgtccgcggctgcatcgcagaccgcaacgctcttcatcggcatcgcgtttgca gaagccctggggatcttcgcgttcctcgtgtcgctgctgctgatgtttgccgtctga

DBGET integrated database retrieval system