KEGG   Thalassococcus sp. S3: CFI11_17160
Entry
CFI11_17160       CDS       T05844                                 
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
thaa  Thalassococcus sp. S3
Pathway
thaa00260  Glycine, serine and threonine metabolism
thaa00750  Vitamin B6 metabolism
thaa01100  Metabolic pathways
thaa01110  Biosynthesis of secondary metabolites
thaa01120  Microbial metabolism in diverse environments
thaa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:thaa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CFI11_17160
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CFI11_17160
Enzymes [BR:thaa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CFI11_17160
SSDB
Motif
Pfam: Thr_synth_N PALP THR4_C NNH3
Other DBs
NCBI-ProteinID: QBF32935
LinkDB
Position
complement(3458019..3459407)
AA seq 462 aa
MKYISTRGQAPELTFEEAMLTGLARDGGLYVPAEIPQMSLGDIASLAGQPYEHVAFRVMR
PFIGETFTDAEFQDIIALAYAGFGHDARAPLVQLNEGHYLLELFHGPTLAFKDFAMQLIG
QLFEEALKRRGDRVTIVGATSGDTGSAAIEAFRGLDAVDVFILYPHGRISEVQRRQMTTP
TEANVHALAVDGDFDDCQARVKDMFNDFDFRDDVRLSGVNSINWARVLAQVVYYFSSAVS
LGAPHRRVSFTVPTGNFGDIFAGYIAKRMGLPIERLVVATNQNDILHRCLNGQGYHKGET
IPSISPSMDIQVSSNFERALFDAYDRDGGAVAQLMEELRSGGFEVSQGAMQALREQYDSG
RVSEEETHQAIADWLGRSGELLCPHSAVGVHVAEALRDKAVPMVTLATAHPAKFPAAVEA
ASGVHPPLPPRMSDLYERSERVTRIANDLGALQDHIRGQIAN
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgaaatacatctcgacccgcgggcaggcgcccgagctgacattcgaagaggcgatgctg
acgggccttgcccgggatggcggcttatacgtgcccgctgagatcccgcagatgagcctg
ggcgatatcgcatccctcgccgggcaaccctacgagcatgtggccttccgtgtcatgcgc
cccttcatcggcgagacgttcacggatgcggagtttcaggacatcatcgcgctggcctat
gcgggctttggccatgatgcacgcgcacccttggtacagctgaacgaggggcactatctg
ctggagctgttccacgggcccacgctggccttcaaggatttcgcgatgcagctgatcggt
cagctgtttgaggaagcgttgaagcggcgcggcgaccgggtgaccatcgtgggcgccacc
agcggcgacacaggctcggccgcgatcgaggcgttccggggtctggatgcggtggatgtg
ttcatcctttaccctcatgggcgcatctcggaagtgcaaaggcggcagatgacaacgccc
accgaggccaatgtccacgcgctggccgtcgatggcgattttgacgattgccaggcgcgc
gtgaaggacatgttcaacgatttcgactttcgcgacgacgtgaggctgtcgggcgtgaat
tcgatcaactgggcgcgggtgctggcacaggttgtgtattacttttcctctgccgtgagc
ctgggcgcaccgcaccgcagggtcagcttcacggtgcccacggggaatttcggagacatc
tttgccggatacattgccaaacgcatgggtctgcccattgaacggctggtcgtcgcgacg
aaccagaacgatatcctgcatcgctgtctgaacgggcaaggctatcacaagggcgagacg
atcccgtcgatcagcccgtcgatggacatccaggtcagctccaattttgaacgcgcgctc
tttgatgcctatgaccgggacggtggcgcggtggcgcagctgatggaggagttgaggtcc
ggcgggttcgaggtgagccagggcgcgatgcaggcgctgagggagcaatacgattcaggc
cgtgtgtcggaggaggaaacgcaccaagcgattgccgattggctggggcggagcggagaa
ttgctgtgccctcattccgctgtcggtgtgcatgttgcagaggcactacgggacaaggcc
gtgccaatggtgacgctggccaccgcgcacccggcgaagtttccggcggcggtggaggcg
gcgagcggtgtgcatccccctcttcccccccggatgtcggacctgtatgagagatcggaa
cgggtgacccggatcgccaatgatctcggcgccttacaggaccatatcagagggcagatc
gccaattga

DBGET integrated database retrieval system