Thalassospira marina: CSC3H3_11835 Help Entry CSC3H3_11835      CDS       T05224                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism thac  Thalassospira marina Pathway thac01100   Metabolic pathways thac01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thac00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CSC3H3_11835    00074 Mycolic acid biosynthesis     CSC3H3_11835   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CSC3H3_11835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 Ribosomal_L50 DUF5783 Motif Other DBs NCBI-ProteinID:  AUG53325 UniProt:  A0A2N3KXQ2 LinkDB All DBs Position complement(2597834..2598070) Genome browser AA seq 78 aa AA seqDB search MSDVADRVKKIVVEHLGVEEDKVTENASFIDDLGADSLDTVELVMAFEEEFGVEIPDDAA EKILTVKDAIDFIEKANG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagtgatgtcgcagatcgcgtgaagaagatcgttgtcgagcacctcggtgttgaagaa gacaaggtcacggaaaacgccagcttcatcgacgatctgggcgccgacagcctggatacc gtcgagctggtcatggcgtttgaagaagaattcggcgttgaaattcccgacgatgccgct gaaaaaattctgaccgtcaaagacgcgattgacttcatcgaaaaggcaaacggctaa

DBGET integrated database retrieval system