Thalassospira marina: CSC3H3_13370 Help Entry CSC3H3_13370      CDS       T05224                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism thac  Thalassospira marina Pathway thac01100   Metabolic pathways thac01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thac00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CSC3H3_13370    00074 Mycolic acid biosynthesis     CSC3H3_13370   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CSC3H3_13370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1805 Motif Other DBs NCBI-ProteinID:  AUG55110 UniProt:  A0A2N3KRT9 LinkDB All DBs Position 2932460..2932708 Genome browser AA seq 82 aa AA seqDB search MQSRQDVYQQLHDYLVDLFEVPSEDISPDARLVEDLDLDSIDAVDLIVKFQELIGKKVPA TEFRSVRTVDDVVEKIHALVNT NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaagccgccaggacgtttaccagcaacttcacgattatctggttgatctgtttgaa gtgcccagcgaagacatttctcccgatgcccgcctggtcgaggacctggacctggacagc attgatgccgttgatctgatcgtgaagtttcaggaactgattggcaaaaaggtgcctgcc accgaattccggtccgtccgcacggtcgatgacgtggtcgaaaagatccatgccctggtc aacacctaa

DBGET integrated database retrieval system