Thalassospira sp. B30-1: IT971_10650 Help Entry IT971_10650       CDS       T11046                                  Symbol rpiB Name (GenBank) ribose 5-phosphate isomerase B   KO K01808   ribose 5-phosphate isomerase B [EC:5.3.1.6] Organism thad  Thalassospira sp. B30-1 Pathway thad00030   Pentose phosphate pathway thad00051   Fructose and mannose metabolism thad00710   Carbon fixation by Calvin cycle thad01100   Metabolic pathways thad01110   Biosynthesis of secondary metabolites thad01120   Microbial metabolism in diverse environments thad01200   Carbon metabolism thad01230   Biosynthesis of amino acids Module thad_M00007   Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P Brite KEGG Orthology (KO) [BR:thad00001]  09100 Metabolism   09101 Carbohydrate metabolism    00030 Pentose phosphate pathway     IT971_10650 (rpiB)    00051 Fructose and mannose metabolism     IT971_10650 (rpiB)   09102 Energy metabolism    00710 Carbon fixation by Calvin cycle     IT971_10650 (rpiB) Enzymes [BR:thad01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.1  Interconverting aldoses and ketoses, and related compounds     5.3.1.6  ribose-5-phosphate isomerase      IT971_10650 (rpiB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  LacAB_rpiB DUF4177 Motif Other DBs NCBI-ProteinID:  QPL37711 LinkDB All DBs Position complement(2182858..2183304) Genome browser AA seq 148 aa AA seqDB search MTAKTIAIAADHGGVELKSQIIKSLAGNGWEVLDLGTDGSTSVDYPDYAKAVAKSIIDGK AERGILVCGSGIGMSIAANRYPQIRAALVHDRLSAELCRQHNNANVLCLGARLLGDATAL DCVNAFMMTEFEGGRHERRVEKLSSLTD NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgacagccaagaccattgccatcgctgccgatcacggtggtgttgaacttaaatcccaa atcatcaagtcgcttgccggaaatggctgggaggttctcgaccttggaaccgacggttct acgtcagttgattacccggattatgcgaaagccgttgccaaatcgattatcgatggcaag gctgaacgcggtattcttgtatgcggttccgggatcggtatgagcatcgctgccaaccga tatcctcaaattcgtgctgccttagtacatgatcgcctgtcagccgaactatgccgtcag cacaacaacgccaatgttctgtgcctcggcgcacgccttttgggtgatgcgacggcgctt gattgcgttaacgcgtttatgatgactgaattcgaaggcggtcgtcacgaacggcgtgtt gaaaaactttcttcacttaccgactga

DBGET integrated database retrieval system