Thalassospira sp. B30-1: IT971_13145 Help Entry IT971_13145       CDS       T11046                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism thad  Thalassospira sp. B30-1 Brite KEGG Orthology (KO) [BR:thad00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:thad03110]     IT971_13145 (groES)    03029 Mitochondrial biogenesis [BR:thad03029]     IT971_13145 (groES) Chaperones and folding catalysts [BR:thad03110]  Heat shock proteins   HSP10    IT971_13145 (groES) Mitochondrial biogenesis [BR:thad03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     IT971_13145 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  QPL34124 LinkDB All DBs Position complement(2725240..2725527) Genome browser AA seq 95 aa AA seqDB search MKFRPLHDRVLVRRVESDTKTAGGIIIPDTAKEKPQEGEIIAVGSGVRKEDGSLVALDVK AGDKVLFGKWSGTEVKVDGEELLIMKESDIMGIME NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaagttccgtccgttacatgatcgtgtgctggtccgtcgtgtcgaatccgacaccaag actgccggtggcatcattatcccggataccgcgaaagaaaaaccgcaggaaggcgagatc atcgctgtcggttccggtgttcgcaaagaagacggctcgcttgtagcgcttgacgtcaag gctggtgacaaggttctgttcggcaaatggtcgggcacagaagtcaaggtcgatggcgaa gagctgctgatcatgaaagagtccgacattatgggcatcatggaataa

DBGET integrated database retrieval system