Thauera sp. GDN1: CKCBHOJB_01540 Help Entry CKCBHOJB_01540    CDS       T09925                                  Symbol dmpM Name (GenBank) Phenol hydroxylase P2 protein   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism thag  Thauera sp. GDN1 Pathway thag00361   Chlorocyclohexane and chlorobenzene degradation thag00362   Benzoate degradation thag00623   Toluene degradation thag01100   Metabolic pathways thag01120   Microbial metabolism in diverse environments thag01220   Degradation of aromatic compounds Module thag_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:thag00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     CKCBHOJB_01540 (dmpM)    00361 Chlorocyclohexane and chlorobenzene degradation     CKCBHOJB_01540 (dmpM)    00623 Toluene degradation     CKCBHOJB_01540 (dmpM) Enzymes [BR:thag01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      CKCBHOJB_01540 (dmpM)     1.14.13.244  phenol 2-monooxygenase (NADH)      CKCBHOJB_01540 (dmpM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM DUF4224 RecA_dep_nuc Motif Other DBs NCBI-ProteinID:  WEN41958 LinkDB All DBs Position 1681280..1681549 Genome browser AA seq 89 aa AA seqDB search MSTVFLALQTNEDTRPIIEAILQDNPSAVVDEQPAMVKINADGRLVVRRETIEELIGRDY DLQELQVNMITMSGNLDQTDDEITLFWKS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcgaccgtattccttgcgttgcagaccaacgaagacacccgcccgatcatcgaggcg atcctgcaggacaacccttcggcggtggtggatgagcagcccgcgatggtgaagatcaac gccgacggccgcctggtcgtccgccgcgaaaccatcgaggagctcatcggccgcgactac gacctgcaggagctgcaggtcaacatgatcacgatgtcgggcaacctcgatcagaccgac gacgaaatcaccctgttctggaaatcctga

DBGET integrated database retrieval system