Thauera sp. GDN1: CKCBHOJB_01854 Help Entry CKCBHOJB_01854    CDS       T09925                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism thag  Thauera sp. GDN1 Pathway thag01100   Metabolic pathways thag01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thag00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CKCBHOJB_01854 (acpP_2)    00074 Mycolic acid biosynthesis     CKCBHOJB_01854 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CKCBHOJB_01854 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 DUF5783 DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WEN42267 LinkDB All DBs Position 2033366..2033605 Genome browser AA seq 79 aa AA seqDB search MENIEQRVKKIVAEQLGVNESEIKTESSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAIDYVNAHLKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagaacatcgaacagcgcgtcaagaagatcgtcgctgagcaacttggcgtgaacgaa tcggagatcaagaccgagtcttcgttcgtcgatgatctgggcgcggattcgctggacacc gtggaactggtcatggcgctggaagaagagttcgagtgcgagatcccggacgaagaggcc gagaagatcaccaccgtccagcaggcgatcgactacgtcaacgcccacctcaagaagtaa

DBGET integrated database retrieval system