KEGG   Thalassospira sp. A40-3: IT893_00950
Entry
IT893_00950       CDS       T08364                                 
Symbol
phnC
Name
(GenBank) phosphonate ABC transporter ATP-binding protein
  KO
K02041  phosphonate transport system ATP-binding protein [EC:7.3.2.2]
Organism
thai  Thalassospira sp. A40-3
Pathway
thai02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:thai00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    IT893_00950 (phnC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:thai02000]
    IT893_00950 (phnC)
Enzymes [BR:thai01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.2  ABC-type phosphonate transporter
     IT893_00950 (phnC)
Transporters [BR:thai02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphonate transporter
    IT893_00950 (phnC)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_29 AAA_16 SMC_N RsgA_GTPase AAA_22 nSTAND1 NACHT nSTAND3 AAA_5 AAA_28 AAA_25 AAA_30 AAA_33 MMR_HSR1 AAA_19 SbcC_Walker_B TsaE DUF87 AAA_23 G-alpha NB-ARC AAA_14 ATPase_2 AAA_24
Other DBs
NCBI-ProteinID: QPO12127
LinkDB
Position
217577..218422
AA seq 281 aa
MLVVDISGLNKSFTRDKRALSGVKLQVREGEMVALIGASGSGKSTLIRHIAGLLRGDRDG
GKIVVFGETIQENGKISRGARKVRSEIGVVFQQFNLVSRLSVLTNVLMGLLGRVPAWRGS
LGLFTKTEKMRAMSALHRVGIDAHASKKARNLSGGQQQRAAIARTITQGARLILADEPIA
SLDPASSRKVMNTLDRVNREDNVTVIVSLHQVDYAKDYCKRTIAMRDGEVVFDGPSSELT
PQFLQELYGEHSSELFADGAAKAAEPVTRPIAEKDLAVATS
NT seq 846 nt   +upstreamnt  +downstreamnt
atgctggttgtagatatctctggactgaacaaaagctttacccgtgacaagcgtgcgctc
agcggcgtcaaactgcaggtgcgggaaggcgagatggtggcgctgattggcgcatcgggt
tcgggtaaatccacactgatccgtcatattgccggtttgctgcgcggggatcgcgatggc
ggcaagattgtcgtgtttggcgaaaccattcaggaaaatggcaagatttcacgcggtgcc
cgcaaggtgcgctccgagattggtgttgttttccagcagttcaatctagttagccgtctt
tcggttctgaccaacgtcctgatggggcttttgggccgtgtgccggcatggcgcgggtcg
cttggtctgtttaccaaaaccgaaaagatgcgcgccatgagcgcgcttcaccgtgttggc
attgatgcccatgcgtcgaaaaaggcgcggaacctttcaggtggtcagcaacagcgcgcg
gcgattgcgcgcaccattacccagggtgcccgacttattcttgccgacgagccgattgca
tcgcttgatccggcatcgtcccgcaaggtgatgaacacgcttgatcgcgtaaaccgcgaa
gacaacgtcaccgtcatcgtatcgcttcatcaggttgattacgcaaaagactactgcaaa
cgcaccatcgccatgcgcgatggtgaagtcgtttttgacggaccgtcaagcgaactgacg
ccgcaattccttcaggaactttacggcgaacattcttccgaactttttgccgatggtgcg
gcaaaggccgcagagcccgttacacggcccatcgcagaaaaggacctggctgtcgcaaca
agctag

DBGET integrated database retrieval system