Thalassospira sp. A40-3: IT893_05980
Help
Entry
IT893_05980 CDS
T08364
Name
(GenBank) SDR family NAD(P)-dependent oxidoreductase
Organism
thai
Thalassospira sp. A40-3
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
adh_short
adh_short_C2
KR
SDR
Epimerase
2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID:
QPO13062
LinkDB
All DBs
Position
complement(1335120..1335830)
Genome browser
AA seq
236 aa
AA seq
DB search
MTDTKRLEGRVALITGASHGIGCAIAKRFAAEGAHVIAIGRNVGALEELSDEVTDAGGKI
TLLPLDLTMFDKIDMLGPTIYERFGKLDIVVGNAGLLGEIAPVGHIDAQVFQNTYATNVT
ANFHLIRTTDKLLQLSEAGRAIFVTSNASAKGRAFWGLYASTKAALESLVLSYAQELEQT
KVKVNLVNPGRIRTKMRAEAYPGEDPQTLPTPESITDVFVDLADTSCTTHGEVVDA
NT seq
711 nt
NT seq
+upstream
nt +downstream
nt
atgaccgataccaagcggcttgaaggtcgcgttgccctgatcaccggggcttcgcacggg
atcggatgtgcgattgccaaacgctttgctgccgaaggcgcgcatgtgattgcgattggt
cgtaatgtcggcgcacttgaagaactcagtgacgaagtgaccgatgccggtggcaagatt
accttgctgccgcttgacctgaccatgttcgacaagatcgacatgctgggtccgacgatc
tatgagcggtttggtaagctcgatatcgtggttggcaatgccggccttctgggcgaaatc
gccccggtgggtcacattgatgcgcaggtgttccagaacacctatgccaccaacgtcacg
gcaaacttccacctgatccgcacgacagataagcttctgcagctgtctgaggccggccgg
gcaatcttcgtgacatcgaacgcatcggccaagggtcgtgccttctggggcctttatgcg
tcgaccaaggcagcgctggaaagcctggttctgtcctatgcgcaggaactcgaacagacc
aaggtcaaggtcaatctggtcaatccgggccgcatccgcaccaaaatgcgtgcagaagcc
tatccgggcgaagatccgcaaacgcttccgacacccgaaagcatcaccgacgtgtttgtc
gatctggcagacaccagctgcaccacgcacggcgaagtggttgacgcttag
DBGET
integrated database retrieval system