Thalassospira sp. A40-3: IT893_08770 Help Entry IT893_08770       CDS       T08364                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism thai  Thalassospira sp. A40-3 Pathway thai01100   Metabolic pathways thai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     IT893_08770    00074 Mycolic acid biosynthesis     IT893_08770   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     IT893_08770 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QPO13579 LinkDB All DBs Position complement(1940541..1940804) Genome browser AA seq 87 aa AA seqDB search MTALENELKAFIIETLNLEDVTVEEIDGEEPLFVEGLGLDSIDALELGVAIQKKYDVRID AKNEDVKTHFASVRNLARFIEQSGKEG NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaccgcgctggaaaacgaacttaaagcctttattatcgagacgcttaaccttgaagac gtcacagtcgaagaaattgacggcgaagaaccgctttttgtcgaggggcttggacttgat tccattgatgcgctcgaactcggggtcgccattcagaagaagtacgacgtacgtattgat gccaagaacgaagatgtcaaaacccacttcgcttcggtccgcaaccttgcgcgcttcatc gaacagtccggcaaggaggggtga

DBGET integrated database retrieval system