Candidatus Endolissoclinum faulkneri L2: A1OE_688 Help Entry A1OE_688          CDS       T02365                                  Name (GenBank) acylcarrier protein   KO K02078   acyl carrier protein Organism thal  Candidatus Endolissoclinum faulkneri L2 Pathway thal01100   Metabolic pathways thal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A1OE_688    00074 Mycolic acid biosynthesis     A1OE_688   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A1OE_688 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Motif Other DBs NCBI-ProteinID:  AFX98876 UniProt:  K7ZCS8 LinkDB All DBs Position 630546..630782 Genome browser AA seq 78 aa AA seqDB search MIDVSERVKKIVVEHLGVDETKVTEDASFIDDLGADSLDTVELVMAFEEEFSCEIPDDAA EKILNVKDAIDFIKSQEG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgattgacgtttctgagagagttaaaaagatcgtcgttgaacatttaggtgttgacgag acaaaggtaacagaagatgccagttttattgatgatctaggcgccgatagtttggatacc gttgagctagtcatggcctttgaggaagagttttcttgcgaaattccagacgatgctgct gaaaaaattttaaatgtcaaagacgcaatcgacttcattaaaagtcaggaaggttga

DBGET integrated database retrieval system