Thermobifida halotolerans: NI17_000075 Help Entry NI17_000075       CDS       T08032                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism thao  Thermobifida halotolerans Brite KEGG Orthology (KO) [BR:thao00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:thao03032]     NI17_000075    03036 Chromosome and associated proteins [BR:thao03036]     NI17_000075    03400 DNA repair and recombination proteins [BR:thao03400]     NI17_000075 DNA replication proteins [BR:thao03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     NI17_000075 Chromosome and associated proteins [BR:thao03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     NI17_000075 DNA repair and recombination proteins [BR:thao03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       NI17_000075 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 Motif Other DBs NCBI-ProteinID:  UOE19708 UniProt:  A0A399G291 LinkDB All DBs Position 13286..13567 Genome browser AA seq 93 aa AA seqDB search MNKRDLIDAISGRLGDKKTATEAVNAVLDTIQQTVAKGDKVAITGFGVFEKAERAARTAR NPSTGATINVPASFVPKFRPGADFKALVNSDEK NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaacaagcgtgatctgatcgacgcgatttcggggcggctgggagacaagaagaccgcc accgaagccgtcaacgccgtgctggacacgatccagcagaccgtcgccaagggcgacaag gtggccatcaccgggttcggggttttcgagaaggccgaacgtgcggcccgcaccgcccgt aacccctcgaccggagccaccatcaacgtccccgcgagcttcgttccgaagttccgtccc ggcgctgatttcaaagccctggtgaacagcgacgagaagtaa

DBGET integrated database retrieval system