Thermobifida halotolerans: NI17_012130 Help Entry NI17_012130       CDS       T08032                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism thao  Thermobifida halotolerans Pathway thao01100   Metabolic pathways thao01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thao00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NI17_012130    00074 Mycolic acid biosynthesis     NI17_012130   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NI17_012130 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 DUF5031 Motif Other DBs NCBI-ProteinID:  UOE17664 UniProt:  A0A399G4D2 LinkDB All DBs Position 2732889..2733128 Genome browser AA seq 79 aa AA seqDB search MAYSDKEILDGLAEIIDEIAGVPAGEVTPEKSFVDDLDIDSLSMVEIAVAAQDKFGVEIP DDQLKDLKTVQDVITYIQK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggcctactcggacaaggagatcctggacggcctcgccgagatcatcgacgagatcgcc ggtgtccccgcgggcgaggtcaccccggagaagagcttcgtggacgacctcgacatcgac tcgctgtcgatggttgagatcgccgtcgccgcgcaggacaagttcggcgtggagatcccc gacgaccagctcaaggacctcaagacggtccaggacgtcatcacctacatccagaagtag

DBGET integrated database retrieval system