Thermobifida halotolerans: NI17_014930 Help Entry NI17_014930       CDS       T08032                                  Symbol atpE Name (GenBank) ATP synthase F0 subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism thao  Thermobifida halotolerans Pathway thao00190   Oxidative phosphorylation thao01100   Metabolic pathways Module thao_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:thao00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     NI17_014930 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:thao00194]     NI17_014930 (atpE) Photosynthesis proteins [BR:thao00194]  Photosystem and electron transport system   F-type ATPase [OT]    NI17_014930 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  UOE18139 UniProt:  A0A399G2N5 LinkDB All DBs Position complement(3353128..3353331) Genome browser AA seq 67 aa AA seqDB search MEGSLNVIGYGISVIGAGIGVGIVFGLGMQAIARQPEARGPLQTNIYIGFALIEALALLG FVLAFAI NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggaaggcagcctgaacgtcatcggttacggcatcagcgtcatcggtgccggtatcggt gtgggcatcgtgttcggcctgggcatgcaggccatcgcccgccagcccgaggcccgcggg ccgctgcagaccaacatctacatcggcttcgccctgatcgaggcgctcgccctgctgggc ttcgtcctcgcgttcgccatctag

DBGET integrated database retrieval system