KEGG   Thermobifida halotolerans: NI17_022320
Entry
NI17_022320       CDS       T08032                                 
Name
(GenBank) trypsin-like peptidase domain-containing protein
  KO
K08372  putative serine protease PepD [EC:3.4.21.-]
Organism
thao  Thermobifida halotolerans
Pathway
thao02020  Two-component system
Brite
KEGG Orthology (KO) [BR:thao00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NI17_022320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:thao01002]
    NI17_022320
Peptidases and inhibitors [BR:thao01002]
 Serine peptidases
  Family S1: chymotrypsin family
   NI17_022320
SSDB
Motif
Pfam: Trypsin_2 Trypsin PDZ_2 PDZ_6 Peptidase_S46 PDZ
Other DBs
NCBI-ProteinID: UOE19424
UniProt: A0A399G1N6
LinkDB
Position
complement(5021263..5023002)
AA seq 579 aa
MSAIDRGSGSSMEEPERPVGPQADADGRENVTDTGAGEASGSTARSEVPPSSSDAAPAAD
PHPGQQRETPEVRRSEVPLRPARHQGPFAPGHTAHQPGPGQHAPGQPGPDQSASGPPPSG
QHPSGPFGSGQHASGPHSSGPHAPAPSSEWARQPEWFERATAHQVQGHQQHTGGWATPSP
RGAFSSHGGGFPPPPHDAPAMPGAAPPETGQRRRGRVVLVAAATALLTSLVVGPAASVAT
AYLVDGETTNSTSSTSAATGDVSRVADKALPSVVSISTAEGGGSGFIISSDGLIVTNNHV
VSGTGEVTVAFNDGSQAEATTVGTDPVSDLAVIQAEGVSGLTPATLGDSDQVAVGARVVA
IGAPLGLSGTVTSGVISALERPVNTGVSGQQPDSPFTLPPEGEQDEPQATTSTVIDAIQT
DAPINPGNSGGPLMNMDGEVIGINTAIATTSGGGLTQSGSIGLGFAIPINQAKPTIDELV
TTGEATYAAIEAAVTVAEDGSGAELVDVTRGGAADQAGLQAGDVIVGVGNRAVTDPNVLI
AEIRSHRPGDTVTVTYERDGRTAEAQVTLSAQSSSDIGN
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgagcgcgatcgaccgcggtagcggttcttccatggaagaaccagaacgccccgtgggc
ccgcaggccgacgccgacggccgggagaacgtcacggacaccggggctggtgaggcgagc
ggctccaccgcccggagcgaggtcccgccctcctcctcggacgccgcccccgcggccgat
ccgcacccgggacagcagcgggagacgcccgaggtcagaaggtccgaggtgccgctgcgt
cccgcacgccaccagggacccttcgcgccgggccacaccgcccaccagcccggcccggga
cagcacgctcccggacagcccggccccgaccagtccgcttccggcccgcccccttcggga
cagcacccgtccgggccgttcggctccggccagcacgcctccggtccccactcctccgga
ccgcacgcgcccgccccgtcctccgagtgggcccgccaacccgagtggttcgagcgggcc
accgcccaccaggtccaggggcaccagcagcacaccggaggctgggccactccgtccccg
cggggagcgttctcctcccacggtgggggcttcccgcccccgccgcacgacgcccccgcg
atgcccggcgccgctccgccggagacgggtcagcggcgccgcggccgggtcgtcctggtc
gccgccgcgaccgcgctgctcaccagcctggtggtcggcccggcggcttccgtggcgacc
gcctacctcgtcgacggcgagacgacgaacagcacctcctcgacatcggcggcgacgggc
gacgtcagcagggtcgcggacaaggccctgccgagcgtggtgtccatctccaccgcggag
ggcggcggcagcggattcatcatcagctccgacggcctgatcgtcaccaacaaccacgtc
gtgtccggcaccggggaagtgaccgtggcgttcaacgacggctcccaggccgaggccacg
accgtcggcaccgacccggtgtccgacctggcggtgatccaggccgagggcgtgtccgga
ctgaccccggccaccctgggcgactccgaccaggtggccgtcggcgcgagggtggtggcc
atcggcgccccgctgggactgtcggggaccgtcacctccggcgtgatcagcgccctggaa
cggccggtcaacacgggagtcagcggacagcagccggacagccccttcacgctgcccccc
gagggggagcaggacgagccgcaggccaccacctcgacggtcatcgacgcgatccagacc
gacgcgccgatcaaccccggcaactccggcggcccgctgatgaacatggacggcgaggtc
atcggaatcaacacggcgatcgcgacgacgagcggcggcgggctgacgcagtcgggctcc
atcggtctgggcttcgccatcccgatcaaccaggccaagcccaccatcgacgaactggtc
acgacgggcgaggccacctacgcggcgatcgaggcggccgtcaccgtggccgaggacggc
tcgggcgcggaactggtggacgtgacccgtggcggcgcggccgaccaggcgggactccag
gcgggggacgtcatcgtcggggtcggcaaccgtgcggtgaccgatcccaacgtgctcatc
gccgagatccgctcacaccggcccggagacaccgtcaccgtcacctacgagcgtgacgga
aggaccgccgaggcccaggtaacgctgtccgcccagtccagttccgacatcgggaactga

DBGET integrated database retrieval system