Pukyongiella litopenaei: C6Y53_01165 Help Entry C6Y53_01165       CDS       T05357                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism thas  Pukyongiella litopenaei Pathway thas01100   Metabolic pathways thas01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thas00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C6Y53_01165    00074 Mycolic acid biosynthesis     C6Y53_01165   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C6Y53_01165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AVO36452 UniProt:  A0A2S0MKR8 LinkDB All DBs Position complement(233795..234052) Genome browser AA seq 85 aa AA seqDB search MNIRDKVIAIIAEQAVLTPSDVSLDNTLEDLGIDSLGLVESIFAIEESFDISIPFNANEP EASDFDISNVAAIVAGIEKLVSEQA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaacattcgagacaaggtgatcgcaatcattgccgagcaagcggtcctgacaccgtcc gacgtgagcctcgacaacacgctggaggatctgggcatcgacagtctcggcctggtcgag agcatctttgccatcgaagagtcgttcgacatctccatcccgttcaatgccaacgaaccc gaggccagcgatttcgacatctcgaacgtcgccgcgatcgtcgcgggtatcgaaaaactc gtttcggaacaggcctga

DBGET integrated database retrieval system