Pukyongiella litopenaei: C6Y53_03395 Help Entry C6Y53_03395       CDS       T05357                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism thas  Pukyongiella litopenaei Pathway thas00190   Oxidative phosphorylation thas01100   Metabolic pathways Module thas_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:thas00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     C6Y53_03395  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:thas00194]     C6Y53_03395 Photosynthesis proteins [BR:thas00194]  Photosystem and electron transport system   F-type ATPase [OT]    C6Y53_03395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  AVO36829 UniProt:  A0A2S0MLS2 LinkDB All DBs Position complement(686498..686734) Genome browser AA seq 78 aa AA seqDB search MEGDIVQMGAYIGAGLACTGMGGAAVGVGHVVGNFLSGALRNPSAAGGQTATMFIGIAFS EALGIFSFLVALLLMFAV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggaaggcgatatcgtacaaatgggtgcttacatcggcgcgggtctggcctgtacgggc atgggcggtgcagcggtcggtgtgggccacgtcgtgggcaacttcctgtccggcgccctg cgcaacccgtcggcagccggcggccagaccgcgaccatgttcatcggtatcgcgttctcc gaagccctggggatcttctcgttcctcgtggcgctgctgctgatgttcgccgtctaa

DBGET integrated database retrieval system