Pukyongiella litopenaei: C6Y53_09275 Help Entry C6Y53_09275       CDS       T05357                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism thas  Pukyongiella litopenaei Brite KEGG Orthology (KO) [BR:thas00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:thas03110]     C6Y53_09275 (grxC) Chaperones and folding catalysts [BR:thas03110]  Protein folding catalysts   Protein disulfide isomerase    C6Y53_09275 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Glrx-like GST_N_3 SH3BGR CLIC-like_N Motif Other DBs NCBI-ProteinID:  AVO37873 UniProt:  A0A2S0MQ90 LinkDB All DBs Position 1870077..1870337 Genome browser AA seq 86 aa AA seqDB search MQPVEIYSSPLCGFCHAAKRLLRQKGVNFSEINVAADPARRSEMVSRASGGRTVPQIFIG DTHVGGCDELYALDRAGKLDALLAPR NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgcaaccggtcgaaatctattcgtcgccgctatgcggcttttgccatgcggccaagcgg ctgctgcgccagaagggcgtgaatttctcggagatcaacgtggcggccgacccggcgcgc aggtccgagatggtgtcgcgggccagcggtggacgcacggtgccgcagatcttcatcggc gatacgcatgtgggcggatgcgatgagctttatgcgctcgatcgcgcgggcaagctcgac gcgctgctggcgccgcgatga

DBGET integrated database retrieval system