Thalassomonas haliotis: H3N35_15895 Help Entry H3N35_15895       CDS       T08805                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism that  Thalassomonas haliotis Pathway that00998   Biosynthesis of various antibiotics that01100   Metabolic pathways that01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:that00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     H3N35_15895 (acpP)    00074 Mycolic acid biosynthesis     H3N35_15895 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     H3N35_15895 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  WDE09798 LinkDB All DBs Position complement(3776653..3776886) Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKITVEQLGVSEAEVKTESSFVDDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYVTANQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtacaatcgaagaacgcgtaaaaaaaataactgttgaacaactgggtgtaagtgaa gcagaagtaaaaactgaatcatctttcgttgatgatttaggtgccgattcacttgacaca gttgagttagtaatggcgttagaagaagaatttgatacagaaattcctgatgaagaagct gaaaaaatcactaccgttcaagctgccatcgactacgttactgctaaccagtaa

DBGET integrated database retrieval system