KEGG   Thalassomonas haliotis: H3N35_24880
Entry
H3N35_24880       CDS       T08805                                 
Symbol
lptG
Name
(GenBank) LPS export ABC transporter permease LptG
  KO
K11720  lipopolysaccharide export system permease protein
Organism
that  Thalassomonas haliotis
Pathway
that02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:that00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    H3N35_24880 (lptG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:that02000]
    H3N35_24880 (lptG)
Transporters [BR:that02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Lipopolysaccharide transporter
    H3N35_24880 (lptG)
SSDB
Motif
Pfam: LptF_LptG FtsX COA8
Other DBs
NCBI-ProteinID: WDE11413
UniProt: A0ABY7VD04
LinkDB
Position
complement(5820949..5822016)
AA seq 355 aa
MRILDWYIGRIITSTTFITLAVFVSVSGIIKFVEQMKSVGKGNYDLAHAALYVLYAIPRD
VEIFFPMAALIGGLIGIGMLASNSELVVMQASGLSRLDIIKSVMKTAMILVMVSMAVGEW
LAPSGEAAAREIRAQAISGGSLISAKNGVWAKDGDYFVHIAEVEDQGRLNKVQVYRFNDQ
LKLDSWLSAESAVYVNNAWQLNNVVDTSIKEEQITQKKAQIQNWQSSLTPEKLGVVTVKP
ESLSVRGLLNYLDYLKANDQDQSRYLLAFWRKAMQPVTVAVMLLVALSFIFGPLRSVSMG
ARIMMGVGTGILFFVCNEVLGSLSLVYQFPPVLGAMMPSLIFITVALYFMNKRAT
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgcgtattcttgactggtatatcggccgtattattacctcgaccacttttattaccctg
gcggtatttgtcagtgtcagcggcattattaagtttgtcgagcagatgaaaagcgtaggc
aaaggcaactacgaccttgcccatgccgccttatatgtactgtatgccattccccgcgat
gtggaaattttcttcccgatggcggccttgatcggcggcctgatcggcataggtatgctt
gccagcaacagcgagctggtggtgatgcaggcatcgggcctatcgcgcctggatatcatc
aaatctgtgatgaaaaccgcgatgattttagtgatggtaagcatggcggttggcgaatgg
ctggcaccaagcggtgaagctgccgccagggaaattcgcgcccaggcaatctccggcggc
agtttgatttccgcgaaaaatggtgtctgggccaaagacggcgattactttgtccatatt
gccgaagtggaagatcaggggcggttaaacaaggtgcaggtataccgttttaatgatcag
ctgaaactcgacagctggttatcggcggaaagcgcggtatatgttaataatgcctggcag
cttaataatgttgttgataccagcatcaaagaagaacaaatcacccagaaaaaagcacaa
atacaaaactggcaatcgagcctgacgccggaaaaactgggtgtggtaacggtaaaacct
gagtctttgtcggtgcgcggcctgctcaattacctggactatcttaaagccaatgaccag
gatcagagccgctacctgctggcgttctggcgtaaggcgatgcagccggtgaccgtcgcc
gtgatgttgctggtagcattgtcgtttatttttggtccgctgcgctctgtgtctatgggg
gcaaggatcatgatgggggttggtaccggtatcttgttctttgtctgtaatgaagtgctt
ggctccttgagcctggtgtatcagttcccgccggtgctcggggctatgatgcctagcctg
atctttattactgttgccctgtattttatgaataaacgggctacttaa

DBGET integrated database retrieval system