Thauera humireducens Piv1: C4PIVTH_0393 Help Entry C4PIVTH_0393      CDS       T09509                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism thau  Thauera humireducens Piv1 Pathway thau01100   Metabolic pathways thau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C4PIVTH_0393    00074 Mycolic acid biosynthesis     C4PIVTH_0393   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C4PIVTH_0393 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  CAH1745558 LinkDB All DBs Position C4PIVTH:complement(400152..400403) Genome browser AA seq 83 aa AA seqDB search MNDTELLAVLIETLQSIAPEVEGSELRPDRPLRQQVDLDSMDWLNFLIGLSERLKVSIPE ADYRRLVTLADLVAYLQGRMTCY NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgaacgacaccgaactgcttgccgtcctcatcgaaacgctgcagtccatcgcccctgaa gtcgagggcagcgagttgcgcccggaccgccccctgcgccagcaagtggatctggactcg atggactggctgaacttcctgatcggcctctccgagcggctcaaggtcagcatccccgag gccgactatcggcgcctggtcacgctggccgacctggtggcctatctgcaggggcggatg acttgctattaa

DBGET integrated database retrieval system