Thauera humireducens Piv1: C4PIVTH_2794 Help Entry C4PIVTH_2794      CDS       T09509                                  Symbol dmpM Name (GenBank) Phenol hydroxylase P2 protein   KO K16244   phenol/toluene 2-monooxygenase (NADH) P2/A2 [EC:1.14.13.244 1.14.13.243] Organism thau  Thauera humireducens Piv1 Pathway thau00361   Chlorocyclohexane and chlorobenzene degradation thau00362   Benzoate degradation thau00623   Toluene degradation thau01100   Metabolic pathways thau01120   Microbial metabolism in diverse environments thau01220   Degradation of aromatic compounds Module thau_M00548   Benzene degradation, benzene => catechol Brite KEGG Orthology (KO) [BR:thau00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     C4PIVTH_2794 (dmpM)    00361 Chlorocyclohexane and chlorobenzene degradation     C4PIVTH_2794 (dmpM)    00623 Toluene degradation     C4PIVTH_2794 (dmpM) Enzymes [BR:thau01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.243  toluene 2-monooxygenase      C4PIVTH_2794 (dmpM)     1.14.13.244  phenol 2-monooxygenase (NADH)      C4PIVTH_2794 (dmpM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM DUF4224 aRib Motif Other DBs NCBI-ProteinID:  CAH1747934 LinkDB All DBs Position C4PIVTH:2885242..2885511 Genome browser AA seq 89 aa AA seqDB search MSTVFLALQTNEDTRPIIEAILQDNPSAVVDAQPAMVKINADGRLVVRRETIEEITGRAY DLQELQVNLITMSGNLDQTDDEITLFWKS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcgaccgtattccttgcattgcagaccaacgaagacacccgcccgatcatcgaggcg atcctgcaggacaacccttcggccgtcgtcgacgcgcagcccgcaatggtgaagatcaac gccgacggccgcctcgtggtgcgccgcgagacgatcgaggagatcaccggccgcgcctac gacctgcaggagttgcaggtcaacctgatcaccatgtcgggcaatctcgatcagaccgac gacgagatcaccctgttctggaaatcctga

DBGET integrated database retrieval system