Thauera humireducens Piv1: C4PIVTH_3960 Help Entry C4PIVTH_3960      CDS       T09509                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism thau  Thauera humireducens Piv1 Pathway thau01100   Metabolic pathways thau01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thau00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C4PIVTH_3960 (acpP)    00074 Mycolic acid biosynthesis     C4PIVTH_3960 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C4PIVTH_3960 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1493 DUF5783 Ribosomal_L50 DUF1896 Motif Other DBs NCBI-ProteinID:  CAH1749100 LinkDB All DBs Position C4PIVTH:complement(4036276..4036515) Genome browser AA seq 79 aa AA seqDB search MENIEQRVKKIVAEQLGVNESEIKIESSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITTVQQAIDYVNAHLKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagaacatcgaacagcgcgtcaaaaagatcgtcgctgagcaacttggcgtgaacgaa tcggagatcaagatcgagtcttcgttcgtcgatgatcttggcgcggattcgctggacacc gtggagctggtcatggccctcgaagaagaattcgagtgcgaaatcccggacgaagaggcc gagaagatcaccaccgtccagcaggcgattgactacgtcaacgcccatctcaagaagtaa

DBGET integrated database retrieval system