Thauera humireducens Piv1: C4PIVTH_4050 Help Entry C4PIVTH_4050      CDS       T09509                                  Symbol ftsB Name (GenBank) Cell division protein FtsB   KO K05589   cell division protein FtsB Organism thau  Thauera humireducens Piv1 Brite KEGG Orthology (KO) [BR:thau00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:thau03036]     C4PIVTH_4050 (ftsB) Chromosome and associated proteins [BR:thau03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     C4PIVTH_4050 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC CENP-H Motif Other DBs NCBI-ProteinID:  CAH1749190 LinkDB All DBs Position C4PIVTH:complement(4130720..4130992) Genome browser AA seq 90 aa AA seqDB search MRWPILILLALVVLLQYPLWLGKGGWLRVWEVDRQLHEQRAENLRLEQRNAGLEAEVRDL KSGNEAIEERARFELGLTRPDEIYVQVPQE NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgcgctggcccatcctgatccttctcgcactcgtcgtgctgctgcagtacccgctttgg ctggggaaaggcggctggctgcgcgtgtgggaggtcgatcgacaactgcacgaacagcgt gcggagaacctgcggctggagcagcgcaatgccggcctcgaggccgaagtgcgcgacctc aagtcgggcaacgaggcgatcgaggagcgggcgcgcttcgaactcggcctgacgcggccg gacgagatctacgtgcaggtgccgcaagaataa

DBGET integrated database retrieval system