Thermofilum adornatum 1910b: N186_03405 Help Entry N186_03405        CDS       T02802                                  Name (GenBank) hypothetical protein   KO K03538   ribonuclease P protein subunit POP4 [EC:3.1.26.5] Organism thb  Thermofilum adornatum 1910b Pathway thb03008   Ribosome biogenesis in eukaryotes Brite KEGG Orthology (KO) [BR:thb00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     N186_03405  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:thb03009]     N186_03405    03016 Transfer RNA biogenesis [BR:thb03016]     N186_03405    03029 Mitochondrial biogenesis [BR:thb03029]     N186_03405 Enzymes [BR:thb01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.26  Endoribonucleases producing 5'-phosphomonoesters     3.1.26.5  ribonuclease P      N186_03405 Ribosome biogenesis [BR:thb03009]  Eukaryotic type   Pre-60S particles    RNases     RNase MRP      N186_03405 Transfer RNA biogenesis [BR:thb03016]  Eukaryotic type   5'processing factors    Ribonucrease P     N186_03405 Mitochondrial biogenesis [BR:thb03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    RNase MRP     N186_03405 SSDB OrthologParalogGFIT Motif Pfam:  RNase_P-MRP_p29 Motif Other DBs NCBI-ProteinID:  AGT35050 UniProt:  S5Z6X4 LinkDB All DBs Position 590958..591242 Genome browser AA seq 94 aa AA seqDB search MKITPRNILRHELIGLEAEVVDSTNPFQIGIRGFILDETYKTLVIGYPGRRKRRVFKSQV KLRVWLPDGQVVKIDGRYLLGRPEERLKKKLYEW NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaaaataactcctagaaacattttgagacatgaattgattggtctcgaagcagaagtt gttgattctactaatcctttccagattgggatcagaggatttatactagatgagacctac aagacacttgttatcggctatccaggtaggcgaaagcgccgagttttcaagagccaagtt aagttgcgtgtctggcttccagatgggcaagtcgtgaagatagatggtagatacttgttg gggcggccagaggaaagattaaagaagaagctatatgagtggtga

DBGET integrated database retrieval system