Thermofilum adornatum 1910b: N186_04515 Help Entry N186_04515        CDS       T02802                                  Name (GenBank) hypothetical protein   KO K09481   protein transport protein SEC61 subunit beta Organism thb  Thermofilum adornatum 1910b Pathway thb03060   Protein export thb04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:thb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     N186_04515    04141 Protein processing in endoplasmic reticulum     N186_04515  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     N186_04515  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:thb04131]     N186_04515   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:thb02044]     N186_04515 Membrane trafficking [BR:thb04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     N186_04515 Secretion system [BR:thb02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    N186_04515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sec61_beta Motif Other DBs NCBI-ProteinID:  AGT35254 UniProt:  S5ZVS9 LinkDB All DBs Position complement(789954..790154) Genome browser AA seq 66 aa AA seqDB search MSSKAKKGSKKEKSSERKPATMPAAGLLTFYEEDIGGIKIRPEIVVVGTFLFVMLVILAH AGVFGP NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgtctagcaaggcgaagaaaggttctaagaaggaaaaatctagcgaacgaaagcccgca acaatgccagcagctggtctattgacgttttacgaggaagacataggcgggataaagatt aggccagaaatagttgttgttggaactttcctcttcgttatgttagttatacttgcgcat gcgggggtctttgggccatag

DBGET integrated database retrieval system