Thermus sp. CCB_US3_UF1: TCCBUS3UF1_7340 Help Entry TCCBUS3UF1_7340   CDS       T01866                                  Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism thc  Thermus sp. CCB_US3_UF1 Pathway thc01100   Metabolic pathways thc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:thc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     TCCBUS3UF1_7340    00074 Mycolic acid biosynthesis     TCCBUS3UF1_7340   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     TCCBUS3UF1_7340 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AEV15782 LinkDB All DBs Position complement(721549..721791) Genome browser AA seq 80 aa AA seqDB search MTEQEIFEKVKAVIADKLSVEPEKITLEARFVEDLGADSLDTVELIMGLEDEFGLEISDE EAEKIRTVKDAVAYIQAKLG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacggagcaggagatctttgaaaaggtcaaggccgttatcgcagacaagctctccgtg gagccggagaagatcacccttgaggcccgcttcgtggaggacctgggggcggactccctg gacacggtggagctcatcatgggcctcgaggacgagttcgggctggagatctccgacgag gaagcggagaagatccgcaccgtcaaggacgcggtggcctacatccaggccaagctgggc tag

DBGET integrated database retrieval system